SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011071 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011071
Domain Number 1 Region: 200-325,369-551
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-33
Family WD40-repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 116-199
Classification Level Classification E-value
Superfamily F-box domain 1.31e-21
Family F-box domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011071   Gene: ENSOGAG00000012368   Transcript: ENSOGAT00000012373
Sequence length 596
Comment pep:known_by_projection scaffold:OtoGar3:GL873557.1:11258669:11392931:-1 gene:ENSOGAG00000012368 transcript:ENSOGAT00000012373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDHSLEEFRRRWQEELSQAQAQRKRRRPEAAERRRPEVAPGRGEQASGYLALAQGLLEG
AGRPPAARATRAEREDAASRSRSPPAREDAGGGEQLVDQLIRDLNEMDDVPFFDIQLPYE
LAINIFQYLDRKDLGRCAQVSKTWKVIAEDEVLWYRLCQQEGHLPESSISDYSCWKFIFQ
ECRAMEQMLRTNWKNRKGAVSELEPVPDAVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDY
VAPFLESEYEEDEPGMQPYVSFVRINSSLAVAAYEDGILNIWDLRTGKYPIHRFEHDARI
QALALSQEDAAVATASAFDVVMLYPNEEGYWQISAEFEVQKLVDYLEIVPDTGRYPVAVA
TAGDLVYLLKAEDSARTLHYVYGQPVTCLDVSANQVAFGVKSLGWVYEGNKILVYSLEAE
RCLSKLGNALGDFTCVNLRNSPPNLMVSGNMDRRVRIHDLRTDKIALSLSAHQLGVSAIQ
MDDWKIVSGGEEGLVSVWDYRMNQKLWEVHSRHPVRHISFNNHSLITANVPYERVVRNAD
LDNFTTHRRHRGLIHAYEFAVDQLAFQSPLPVCRSSSDAMAGYNYDLALAFPYDHM
Download sequence
Identical sequences H0X6R5
ENSOGAP00000011071 XP_003789987.1.62490 ENSOGAP00000011071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]