SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011137 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011137
Domain Number 1 Region: 55-181
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.67e-41
Family Ornithine decarboxylase antizyme-like 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011137   Gene: ENSOGAG00000012443   Transcript: ENSOGAT00000012443
Sequence length 188
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:17069079:17073315:-1 gene:ENSOGAG00000012443 transcript:ENSOGAT00000012443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFSVSCSSILPLSNCPQLQCCRHIVPGPLWCDAPHPLSKIPGGRGGSRDPSLSALIYKDE
KLTVTQDLPVNDGKPHIVHFQYEVTEVKVSSWDAVLSSQSLFVEIPDGLLADGSKEGLLA
LLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFLGFEIVRPGHPCVPSRPDVMFMVYPL
DQNLSDED
Download sequence
Identical sequences H0X6X2
ENSOGAP00000011137 ENSOGAP00000011137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]