SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011249 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011249
Domain Number 1 Region: 6-34,74-138
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.11e-23
Family Voltage-gated potassium channels 0.0039
Further Details:      
 
Domain Number 2 Region: 140-247
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.09e-20
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011249   Gene: ENSOGAG00000012557   Transcript: ENSOGAT00000012561
Sequence length 312
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:7058414:7064560:1 gene:ENSOGAG00000012557 transcript:ENSOGAT00000012561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKQSARTAALILCILSYLLVGAAVFDALESEAERGRQRLLAQKRGEFRRKYGFSAEDYR
ELERLARQAEPHRAGRQWKFAGSFYFAITVITTIGYGHAAPGTDSGKVFCMFYALLGIPL
TLVTFQSLGERLNALVWRLLLAAKRCLGLRRPRVSTQNMVVAGLLACVATLALGAAAFAH
FEGWTFFHAYYYCFITLTTIGFGDFVALQSDEALQRKPPYVAFSFLYILLGLTVIGAFLN
LVVLRFLAASADLPQRAAGRASLRRLGAPGSSGLARPGSPPHPGGSASVSHRVHQLETCA
RDNLGFSPPSSP
Download sequence
Identical sequences H0X774
ENSOGAP00000011249 ENSOGAP00000011249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]