SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011258 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011258
Domain Number 1 Region: 116-185
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000123
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011258   Gene: ENSOGAG00000012569   Transcript: ENSOGAT00000012571
Sequence length 193
Comment pep:known_by_projection scaffold:OtoGar3:GL873541.1:9511366:9511947:1 gene:ENSOGAG00000012569 transcript:ENSOGAT00000012571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLRETFLSLEGDLGSSDSPGLLSSWDWKDRAGPFELNQASPAQSLSPAPSLESYSSSP
CPAVAGLPPEHDGASSRGSDDCGVQGAGGLVEVDYNMLAFPHAYLQGAGGPKAQKGTKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTD
LLNRGREPRAQSA
Download sequence
Identical sequences H0X782
ENSOGAP00000011258 ENSOGAP00000011258 XP_003787458.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]