SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011301 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011301
Domain Number 1 Region: 570-757
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 300-475,505-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011301   Gene: ENSOGAG00000012615   Transcript: ENSOGAT00000012619
Sequence length 1099
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:1482606:1649385:-1 gene:ENSOGAG00000012615 transcript:ENSOGAT00000012619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSTFICNTHIIPVKNQEGVAMMFIINFEHVADDKNAASPERVNPILPVKTVNRKLFGFKF
PGLRVLTYRKQSLPQEDPDMVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQP
SKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSGSQLTHSRSRESLCSIRRASSVHDIEGF
NVHPKNIFRDRHASEDNGRNIKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDV
KTEKKNTSPPSSDKTIIAPKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILH
YSPFKAVWDWLILLLVIYTAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMF
IIDILINFRTTYVNQNEEVVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTL
IGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLT
DKIGWLDSLGQQIGKRYNDSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKI
FSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEE
YFQHAWTYTNGIDMNMVLKGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFK
TTHAPPGDTLVHCGDVLTALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSN
ADVRALTYCDLHKIQREDLLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLLRSQSMN
DSEGDNCKLRRRKLSFESEGERANSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSI
DDEQKPLFSGMVDSSPATMGKASGLNFEETLPNSGRMHIDKRSHSCKDVTDMRSWEGANV
QTRPERPEESSPSALQRAAWGVSETESDLTYGEVEQRLDLLQEQLNRLESQMTADIQTIL
QLLQKQSAVVPPAYSMVTAGAEYQRPVLRLMRTSHPAASIKTDRSFSPSSQCPEFLDLEK
SKLKSKESLSTGVHLNTASEDNLTSLLKQDSDLSLELHPRQRKTYLHPIRHPSLPDSSLS
PVGILGLHRHVSDPGLPGK
Download sequence
Identical sequences H0X7C1
ENSOGAP00000011301 ENSOGAP00000011301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]