SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011302 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011302
Domain Number 1 Region: 97-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.21e-43
Family Voltage-gated potassium channels 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011302   Gene: ENSOGAG00000012616   Transcript: ENSOGAT00000012620
Sequence length 695
Comment pep:known_by_projection scaffold:OtoGar3:GL873663.1:2227469:2281943:-1 gene:ENSOGAG00000012616 transcript:ENSOGAT00000012620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPG
PGSGSGSACGQRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLST
IQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDFI
VFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELIT
AWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLA
AGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDMSRA
YLTATWYYYDSILPSFRELALLFEHVQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCHR
PGSASFCPGESSRMGIKDRIRMGSSQRRTGPSKQHLAPPPMPTSPSSEQVGEATSPTKVQ
KSWSFNDRTRFRASLRLKPRTSTEEGPSEEVVEEKSYQCELTVDDVMPAVKTVIRSVRIL
KFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKSRERG
DKGPSDTEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTVQVPLF
DPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Download sequence
Identical sequences H0X7C2
XP_003799017.1.62490 ENSOGAP00000011302 ENSOGAP00000011302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]