SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011354 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011354
Domain Number 1 Region: 52-179
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-46
Family Regulator of G-protein signaling, RGS 0.000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011354   Gene: ENSOGAG00000012669   Transcript: ENSOGAT00000012674
Sequence length 205
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:28342606:28347695:-1 gene:ENSOGAG00000012669 transcript:ENSOGAT00000012674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHSKKDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLANP
ASTGSEKQKGAKSSADCASLVPQCA
Download sequence
Identical sequences H0X7G7
ENSOGAP00000011354 ENSOGAP00000011354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]