SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011356 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011356
Domain Number 1 Region: 53-180
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-45
Family Regulator of G-protein signaling, RGS 0.00000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011356   Gene: ENSOGAG00000012674   Transcript: ENSOGAT00000012676
Sequence length 181
Comment pep:known_by_projection scaffold:OtoGar3:GL873535.1:28240738:28294352:1 gene:ENSOGAG00000012674 transcript:ENSOGAT00000012676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKAQKPSPDEALQ
WRDCLDKVLQNDYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEF
IQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDVAQKRIHALMEKDSLPRFVRSEFYQELI
K
Download sequence
Identical sequences H0X7G9
ENSOGAP00000011356 XP_003785800.1.62490 ENSOGAP00000011356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]