SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011376 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011376
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.04e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000193
Further Details:      
 
Domain Number 2 Region: 127-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.88e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000504
Further Details:      
 
Domain Number 3 Region: 299-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.89e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011376   Gene: ENSOGAG00000012692   Transcript: ENSOGAT00000012697
Sequence length 613
Comment pep:known_by_projection scaffold:OtoGar3:GL873628.1:1871020:1910795:-1 gene:ENSOGAG00000012692 transcript:ENSOGAT00000012697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGAMKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPPELQMTRQMASSGAS
GGRIDNSMLVLLVGLSTIGAGAYAYKTIKDDQKRYNERISGLGLTPEEKQKRAASSALEG
EPGPQVRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
SMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREV
KSITIIGGGFLGSELACALGRKAQALGTEVIQLFPEKGNMGKVLPEYLSNWTMEKVRGEG
VKVMPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
IAIPPNTPTVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences H0X7I8
XP_003796986.1.62490 ENSOGAP00000011376 ENSOGAP00000011376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]