SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011492 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011492
Domain Number 1 Region: 547-961
Classification Level Classification E-value
Superfamily RNI-like 8.64e-93
Family 28-residue LRR 0.0000048
Further Details:      
 
Domain Number 2 Region: 40-145,172-266
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000594
Family RecA protein-like (ATPase-domain) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011492   Gene: ENSOGAG00000012822   Transcript: ENSOGAT00000012827
Sequence length 980
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:35797231:35821124:1 gene:ENSOGAG00000012822 transcript:ENSOGAT00000012827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLGDRTEYRIQIKEKFGIVWDRNSLLGKPEDFHQGISQGQKLLEHLFDVDVKTGEQPQVV
VLQGAAGVGKTTLVRKAMLDWAEGNLYQQKFAYVFYLSGREINLMKERSFAQLISQDWPS
IEGSIDRIMSQPSSLLFIIDSFDELNFAFEEPEFALCKDWTQEHPVSFLISSLLRKVMLP
ESSLLVTLRLTASKRLKPLLKSHYHFVELPGMSEDARKECIYQFFEDEKSAMNAFSSLRN
NEMIFSICQVPLVCRLICTCLKQQIEKGSNVSLTCQTTTALFTCYICSLFTVIEGHFPRL
PSQDQLSSLCHLAAKGVWTMTYVFYREDLRRHGLTKLDVSIFLDMNILQRDPEYENCFVF
IHLHVQEIFAAMFYVLEGSQKARGHSFQPFEDITLLLESKSDEDSHLTQMKCFLFGLLNE
DLAKQLEKTLNCKMSLEIKSKVLQWLEALGNSESSPPQLECLEWFHYLYETQDEAFVSQA
MKYFPKVVINICGKTHLFVSSFCLKHCQCLQTIKLSITVVFEKKMLNTSLPAETCRQSDV
DRITHYWQELCSVLHTNEDLRELELCHSNLDKLAMKIFNQELRHPKCKLQKLRLSFVTFP
VTACRGISSSLTHNKNLMHLDLKGNDIGDNGVKLLCEALKHPECKLQKLSLESCNLTEVC
CLDIFNALIRSQSLIFLNLSTNNLLDDGVKLLCEALRYPKCYLERLSLESCGLTEDVCED
LSLALISNKRLTHLCLANNALGDSGIKLMSDVLQNPCCTLQLSLWLRHCHFTLLSSEYLS
TSLLHNKSLTHLDLGSNRLQDDGAKLLCDAFRHPSCNLRDLELMGCVLTSACCLDLASVV
LSNPNLWSLDLGKNDLQDEGVKILCDALRHPDCSIQRLGLECCGLTSLSCEDLSSTLSSN
QRLKKMNLAQNDLRCEGIRKLCQALKSPDCKLQVLGLCKEAFDEEAQKLLEAVRVSNPHL
IIKPDCNDNNEEDGSWWRCF
Download sequence
Identical sequences H0X7T4
ENSOGAP00000011492 ENSOGAP00000011492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]