SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011522 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011522
Domain Number 1 Region: 7-238
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-42
Family Voltage-gated potassium channels 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011522   Gene: ENSOGAG00000012854   Transcript: ENSOGAT00000012858
Sequence length 754
Comment pep:known_by_projection scaffold:OtoGar3:GL873581.1:7897033:7938323:1 gene:ENSOGAG00000012854 transcript:ENSOGAT00000012858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGFLVSFFFFRFLIVLGCLILAVLTTFKEYETASGDWLLLLETFAIFIFGAEFALRIWAA
GCCCRYKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRML
RMDRRGGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKE
EFETYADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALK
VQEQHRQKHFEKRRKPAAELIQAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEA
GASQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRM
KAYAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFRLYKKKFKETL
RPYDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGAAFTYPSQQS
PRNEPYVARPSTSETEDQSMMGKFVKVERQVQDMGRKLDFLVDMHMQHMERLQVQVTELG
PAQGSASPAGGQKEEDNRYSDLKTIICNYSETGPPDPPYSFHQVPIDKVGPYGFFAHDPG
DLPRGGPSSGKSQGTLPSSVTTYAERPTVLPILTLLDSRVSCHSQAELHGPYSDGISPRQ
RCSVTRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYAFGPNGGSSWMREKRYLAEGET
DTDTDPFTPSGSMPLSSTGDGISDSIWTPSNKPI
Download sequence
Identical sequences H0X7V7
ENSOGAP00000011522 ENSOGAP00000011522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]