SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011575 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011575
Domain Number 1 Region: 1272-1434,1462-1541
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.16e-39
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 772-999
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.46e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 99-254,357-424
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-36
Family Voltage-gated potassium channels 0.011
Further Details:      
 
Domain Number 4 Region: 1595-1846
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.66e-35
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011575   Gene: ENSOGAG00000012907   Transcript: ENSOGAT00000012917
Sequence length 2323
Comment pep:known_by_projection scaffold:OtoGar3:GL873563.1:7345861:7406250:1 gene:ENSOGAG00000012907 transcript:ENSOGAT00000012917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGALAADEVRVPLGAPPPGLAAAEASLASPGVPGREGERGSEPSASPPESPVAERGVE
LGTDEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCCTWFEHISMLVIMLNCVTLGMFR
PCEDVECHSERCAILEAFDDFIFAFFAVEMAIKMVALGLFGQKCYLGDTWNRLDFFIVMA
GMMEYSLDGHNVSLSAIRTVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVF
FIFGIVGVQLWAGLLRNRCFLDSTFVRNNNLTFLRPYYQTEEGEENPFICSARRDNGMQK
CSHIPGRRELRVPCTLGWEAYGQPLAEASSGTSHNACINWNQYYNVCRSGDSNPHNGAIN
FDNIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIAT
QFSETKQRESQLMREQRARHPSNDSTLASFSEPGSCYEELLKYVGHIFRKVKRRSLRLCA
RWQNRWRKKVDPSGALHGQGPGHRQRRAGGRAASVHHLVYHHHHHHHHHYHFSPSSPRGP
GPEPGAGDTRLVRAGRPPSPPSPGHGPPDTESVHSIYHADCHVEGPQERARVAHAAATAA
ASLKLATGLGAMNYPTILPSGPNGGKGGTSPLPEGKQAGPHPYEKIQHVVGEHGLGRASS
HLSGLSVPCPLPSPQAGTLTCELKNCPYCASALEDPEFEFSGSESGDSDSRGVYEFTQDV
QHSDHRDPVQPPLEVGTPGQGRPRRRVASGQPGRLGRLWATFSCKLHRIVDSKYFNRGIM
VAILINTLSMGVEHHEQPDELTNALEISNIVFTSMFALEMLLKLLACGPLGYIRNPYNIF
DGIIVVISVWEIVGQADGGLSVLRTFRLLRVLKLVRFLPALRRQLVVLVKTMDNVATFCM
LLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDTLLWAIVTVFQILTQEDWNVVL
YNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDASRSDTDEDKTSTHFEE
DFDKFRNLRTMEMKTYALAMTPNGPLEGRGSLPPPVIVRTAATPMPTPKSSPHLDPAPGP
LGSRRGSDSSTEPQLGDQKSLASLHSSPCTPWGPNSAWSSRRSSWNSLGRAPSLKRRSQR
GERESLLSGEGKGSTDDEADDSRPGEGARTTPLRRTESLGHLPVDAALLPSKSHDCNGQT
MALPSELFLRIDSHREDPAECDEDMEASCCFRLHKVLEPYKPQWCRSRESWALYLFSPQN
RLRVSCQRTIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERTFLSVSNYVFTAIFVA
EMMMKVVALGLLAGEHAYLQSSWNVLDGLLVLVSLVDIIVAMASAGGAKILGVLRVLRLL
RTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGILGVQLFKGKFYYCEG
SDTRNISTKAECWAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWVNIMYDGLDAVGVDQ
QPVQNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLQRL
ERRRRSTFPNPEAQRRPYYADYSPTRRSIHTLCTSHYLDLFITFIICVNVITMSMEHYNQ
PKSLDEALKYCNYVFTIVFVFEAALKLVAFGFRRFFKDRWNQLDLAIVLLSIVGIALEEI
ETSAALPVNPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFF
IYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTGDNWNGIMKDTLREC
TREDRHCLSYLPALSPVYFVTFVLVAQFVLVNVVVAVLMKHLEESNKEAREDAEMDAEIE
LEMAQGPPARADTDRPPSPQESPDTPSLLVVRKVSVSRMLSLPNDSYMFRPVAPASARHP
HPLQEVEMETYATYLPAPGTATTAHSPPVEPHASLQVLSVMSSPAKGSSDALHSPSPRGR
PRSPSLSLLLCRQEAVHTESLKGHSDGLRDSILVSGEPEKTPVRQVSLGDSPEPTSIHTR
KHTFGQHCISSQPPAPGRDEAEAADPADEEVSHITSTAHTWQPPAEPHGLAKAGDEQALC
SLYSVNTQGFLDEPGRADEQRWPLAELGSGNHSPEPGEVKAQVLEAELTLGARRKKKMSP
PCISVDPPAEDESSTRPPTVPGSTTLRRRTPSCEATPHRESLEPAEVLGAGGDPAARGER
WGQVPCRAEHLTVPSFAFRPLDLGGSEEDPFLDSGHTMASEPRASASGTTAPLEPQETEP
PIPSGDPPEKRRGLYLTIPQASLKKPGSPPAAPAPGNGTDEPV
Download sequence
Identical sequences H0X802
ENSOGAP00000011575 ENSOGAP00000011575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]