SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011581 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000011581
Domain Number - Region: 37-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000117
Family I set domains 0.0029
Further Details:      
 
Domain Number - Region: 85-153
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00556
Family MATH domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011581   Gene: ENSOGAG00000012922   Transcript: ENSOGAT00000012923
Sequence length 198
Comment pep:known_by_projection scaffold:OtoGar3:GL873627.1:6256897:6267231:-1 gene:ENSOGAG00000012922 transcript:ENSOGAT00000012923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWGTLWKVLGLCLLSVGAWGQEENEETGSSALRPYKVSISGTTVTVKCPLDTEHDINWA
KKDQELKDYKNQEDLILDNFSEMENSGYYACYTGNKDDISHYLYLRARVCENCMEVDVMA
VVTIIIVDVCITLGLMMLVYYWSKNKKAKAKPVTRGMGAGGRLRGQNKERPPPVPNPDYE
PIRKGQRDLYSGLNQRGI
Download sequence
Identical sequences H0X808
XP_003796902.1.62490 ENSOGAP00000011581 ENSOGAP00000011581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]