SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011643 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011643
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.62e-27
Family Forkhead DNA-binding domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011643   Gene: ENSOGAG00000012998   Transcript: ENSOGAT00000013000
Sequence length 364
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:394165:395672:1 gene:ENSOGAG00000012998 transcript:ENSOGAT00000013000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPCSNSCRGPLEAQSPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQII
RQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFLKVPKDPAKPQAKGNFWAVDVSLIPAEAL
RLQNTALCRRWQNGGTHRAFAKDLGPYVLHGQPYRPSGPPPPCEGFSIKSLLGNPGEEAS
LRPRLATQSSPALGGTRNGRAEVVPTLPLPSPERPLWPLPGPATVEGETSPKGAIGPTFL
SSEPRAWSLHLIQDTPAPGGLSSGGHRSSFWGQLPTSYLPIYAPNVVVPLAPPPPSSCPR
CPPSTSPAYWKLAPETPRAPRLLWDLDAFFQGVPPNKSIHDVWVSQPQDLAAPTPSWLLS
WHNL
Download sequence
Identical sequences H0X860
ENSOGAP00000011643 XP_003802395.1.62490 ENSOGAP00000011643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]