SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011653 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011653
Domain Number 1 Region: 181-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.17e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0081
Further Details:      
 
Domain Number 2 Region: 498-583
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.2e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 
Domain Number 3 Region: 113-159
Classification Level Classification E-value
Superfamily ISP domain 0.000000000144
Family Rieske iron-sulfur protein (ISP) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011653   Gene: ENSOGAG00000013007   Transcript: ENSOGAT00000013011
Sequence length 590
Comment pep:known_by_projection scaffold:OtoGar3:GL873737.1:45311:58026:-1 gene:ENSOGAG00000013007 transcript:ENSOGAT00000013011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGGPRVLGWTALKPTICAPLANPASGHSPWAAASPSPSQWSSRLKWCCRRRSGARKSCQP
AGRAALGPTRAMAQLDTSTQRSACPPLTPTPAPWTVWRLLSAMSRTLRMASVLSRGRVRC
PWHGACFNISTGDLEDFPGLDSLPKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPS
AGHSGSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQ
LALRPKEFFRAYGIEVLTEAQVVTVDVRNKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKG
KEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAFLTEKAHSVSVVELEETPF
RKFLGERVGRALMKIFENNWVKFYMQTEVSELRAQEGKLKEVVLKSSKVVRADVCVVGIG
AVPATGFLRQSGISLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQM
AHAQGRVAAQNMLAQEAEISTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAF
YTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS
Download sequence
Identical sequences H0X870
ENSOGAP00000011653 ENSOGAP00000011653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]