SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011668 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011668
Domain Number 1 Region: 1190-1345,1387-1463
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-39
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1513-1703,1737-1762
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.8e-38
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 126-270,341-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.82e-32
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 744-891,925-972
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.88e-30
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000011668
Domain Number - Region: 1770-1814
Classification Level Classification E-value
Superfamily EF-hand 0.00489
Family Calmodulin-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011668   Gene: ENSOGAG00000013021   Transcript: ENSOGAT00000013028
Sequence length 1986
Comment pep:known_by_projection scaffold:OtoGar3:GL873609.1:5190370:5298061:-1 gene:ENSOGAG00000013021 transcript:ENSOGAT00000013028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMLPPPGPQSFVHFTEQSLALIEQRIAEGKTKEPKEEKKDSDDEGPKPSSDLEAGKQLP
FIYGDIPRGMVSEPLQDLDPYYADKKTFIVLNKGKAIFRFNATPALYMISPFNPLRRLSI
KILCTTLFSMLIMCTILTNCIFMTMSNPPEWTKNVEYTFTGIYTFESLVKILARGFCIGE
FTFLRDPWNWLDFIVIVFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQ
SVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNTTENNNETLQNIMNTVEDEEEF
RKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKAGRNPDYGYTSFDTFSWAFLALFRLMT
QDYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQK
ELEFQQMLDLLKKEQEEAEAIAAAAAEYTSIGRSRIMGLSESSSETSKLSSKSAKERRNR
RKKKNQKKLSSGEEKGDDEKLSKSESEENVRRKSFLGVEGYRQAREKRLSTPNQSPLSIR
GSLFSARRSSRTSLFSFKGRGKDLGSETEFADDEHSIFGDNESRRGSLFVPHRPPERRSS
NISQASRSPPLLPVNGKKHSAVDCNGVVSLVDGPSALMLPNGQLLPEVIIDKATSDDSGT
TNQIHKKRRPSSYLLSEDMLNDPCLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHT
FLIWNCSPYWIKFKKFIHFIVMDPFVDLAITICIVLNTLFMAMEHHPMTKEFENVLAVGN
LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVEFFLSDVEGLSVLRSFRLL
RVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIN
DDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVL
NLFLALLLSSFSSDNLTAIEEDPDANNLQIAVNRIQKGINYTKQTLREFVLKAFSKKPKI
SREIRQGEDLNTKKQNYISNHTLAEMSKDHNFHKEKDKIGGFGSSMDKYLMEESTCQSFI
HNPSLTVTVPIALGESDLENMNTEELSSDSESEYSKERLNRSSSSECSTVDNPLPGEEEA
EAEHVNSDEPEACFTEGCVRRFPCCQVNIESGKGKIWWNIRKTCYRIVEHSWFESFIVLM
ILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILELLLKWVAYGYKTYFTNAWCWL
DFLIVDVSLVTLVANALGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPSI
MNVLLVCLIFWLIFSIMGVNLFAGKFYECVNTTNGSRFPATQVKNRSECFALMNVSENVR
WKNLKVNFDNVGLGYLSLLQVATFKGWMDIMYAAVDSVNVNEQPKYEHSLYMYIYFVIFI
IFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGN
KFQGCIFDIVTNQAFDITIMVLICLNMVTMMVEKEDQSDEMTNVLYWINVVFITLFTGEC
VLKLISLRHYYFTVGWNIFDFVVVILSFVGMFLAGLIKKYFVSPTLFRVIRLARIGRILR
LIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGINDMFNFE
TFGNSMICLFQITTSAGWDGLLAPILNSEPPDCDPKKVHLGSSVEGDCGNPSVGIFYFVS
YIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEYSKL
SDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGEGGEMDSLRSQ
MEERFMSANPSKVSYEPITTTLKRKQEDVSAIVIQRAYRRYCLQKNVKNISSVYIKDGDR
DEDFPSKEDMVLDNVNKNSSLENTDATPSTISPPSYDSVTKPDREKYEKDRTEKEDKGKD
GKERKK
Download sequence
Identical sequences H0X882
ENSOGAP00000011668 ENSOGAP00000011668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]