SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011671 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011671
Domain Number 1 Region: 12-122
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-22
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 2 Region: 199-301
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.65e-20
Family Platelet-derived growth factor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011671   Gene: ENSOGAG00000013030   Transcript: ENSOGAT00000013031
Sequence length 308
Comment pep:known_by_projection scaffold:OtoGar3:GL873604.1:651093:879002:-1 gene:ENSOGAG00000013030 transcript:ENSOGAT00000013031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQDPQHERVITVSSNGSIHSPRFPHTYPRNMVLVWRLVAVEENVWIQLTFDERFGLEDPE
DDLCKYDFVEVEDPNDGAILGRWCGSGAVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHY
NIVMPQFTEAVSPSVLPPSALPLDLLNNAVTAFSTLEDLIRYLEPDRWQLDLEDLYRPTW
QLLGKAFVFGRKSRGHVVVDLNLLKEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLV
KRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKNGVRGLHKSLTDIALEHHEECDC
VCRGNTGG
Download sequence
Identical sequences H0X885
ENSOGAP00000011671 ENSOGAP00000011671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]