SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011717 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011717
Domain Number 1 Region: 175-372
Classification Level Classification E-value
Superfamily E set domains 3.59e-78
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000391
Further Details:      
 
Domain Number 2 Region: 66-191
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.53e-23
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011717   Gene: ENSOGAG00000013078   Transcript: ENSOGAT00000013081
Sequence length 419
Comment pep:known_by_projection scaffold:OtoGar3:GL873616.1:2732631:2737780:1 gene:ENSOGAG00000013078 transcript:ENSOGAT00000013081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDSRNAMNQDMEIGVTPWDPRKIPKQARDYVPVATDRTRLLADGKKPRQRYMEKSGKC
NVHHGNVRETYRYLSDLFTTLVDLKWRFNLLVFTMVYTTTWLLFGFIWWLIAYIRGDLDH
VGDQDWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNA
FMVGCMFVKISQPKKRAETLMFSNNAVISMRDDKLCLMFRVGDLRNSHIVEASIRAKLIK
SRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLDQEEFE
VVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTP
SCCAKELAEMKREGRLLQYLPSTPLPGGCAEPDPDVETEQEGEDNPKGLSESQDSSGSV
Download sequence
Identical sequences H0X8C0
ENSOGAP00000011717 XP_003795944.1.62490 ENSOGAP00000011717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]