SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011798 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011798
Domain Number 1 Region: 31-137
Classification Level Classification E-value
Superfamily SRCR-like 1.22e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 309-412
Classification Level Classification E-value
Superfamily SRCR-like 5.89e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 420-536
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00096
Further Details:      
 
Domain Number 4 Region: 173-294
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011798   Gene: ENSOGAG00000013165   Transcript: ENSOGAT00000013171
Sequence length 756
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:22299637:22313651:1 gene:ENSOGAG00000013165 transcript:ENSOGAT00000013171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWFPSAAFSLFLLLLLHQAPTSRSQSLGTKKLRLVGPGNRPEEGRLEVLYQGQWGTVCD
DDFALREATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVHCAGTESSLDQCGSNGWGV
SDCSHSEDVGVMCHPQRQRGYPSEKVSNALGPQGQWLEEVRLKPILASTRRHSPVTEGAV
EVKYDGHWRQVCDQGWTMNNSRVVCGMLGFPSEQPINSHYYRKVWNLKMKDPKYRLNSLA
NKNSFWIHRVNCLGTEPHMANCQVQVAPARGKLHPACPGGMHAVVSCVAGPRFRPPKMKP
RRKESWGEEPRVRLRSGAQVGEGRVEVLVNHQWGTVCDHRWNLISASVVCRQLGFGSARE
ALFGAQLGQGLGPIHLSEVRCRGHERTLSDCLALKGPQNGCQHENDAAVRCNVPNMGFQN
QVRLAGGRSPEEGVVEVQVEVNGVQRWGSVCSDHWGLTEAMVACRQLGLGFANHAIKETW
YWQGTPGAGEVVMSGVRCSGTELALQQCQRHGPVHCSHGTGRSAGVSCMDSAPDLVMNAQ
LVQQTAYLEDRPLSLLYCAHEENCLSQSADHMDWPYGHRRLLRFSTQIYNLGRADFRPKT
GRHSWIWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACAN
FGEQGVTVGCWDTYRHDIDCQWVDITDVGPGDYIFQVVVNPKYEVAESDFSNNMMRCRCK
YDGQRVWLHNCHTGDSYPADTEHSLEQEQRLRNNLI
Download sequence
Identical sequences H0X8H5
ENSOGAP00000011798 XP_003787330.1.62490 ENSOGAP00000011798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]