SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011819 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011819
Domain Number 1 Region: 75-204,392-544
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.62e-27
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 2 Region: 8-73,100-133
Classification Level Classification E-value
Superfamily F-box domain 2.09e-20
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011819   Gene: ENSOGAG00000013190   Transcript: ENSOGAT00000013193
Sequence length 568
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:1141173:1144383:1 gene:ENSOGAG00000013190 transcript:ENSOGAT00000013193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGGTPLLPDCLIYQIFLSLGPADVLAAGQVCRQWHAVSLDEFLWREQFYRYYQVARDV
PRHPAATSWYEEFRRLYDMVPCVEVQTLREHSDQVLHLSFSHSGYQFASCSKDCTVKIWN
NDLTISLLHSADMRPYNWSYTQFSQFNQDDSLLLASGVFLGPHNSSSGEIAVISLDSFVL
LSRVRNKPYDVFGCWLTETSLISGNLHRIGDITSCSVLWLNHAFQDVESENVNVVKRLFK
IQNLNASTIRTVMVADCSRFDSPDLLLDAGDTATAPCRVFDLGSSSDSEDEVAGPAPAHA
KEGFRRFLDRVLDGRTQPPLSERVLETRVAKLLAQGHTKPPERSTASTRNKYLIFTTGCL
TYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDVHGHIIGMGLSPDNRYLY
VNSRAWPSGAVVADPMQPPPIAEEIDLLVFDLKTMREVRRALRAHRAYTPNDECFFIFLD
VSRDFVASGAEDRHGYIWDRHYNICLAKLQHEDVVNSVAFSPQEQELLLTASDDATIKAW
RSPRTVRTLQAPRPHPRPFFSWFANQRR
Download sequence
Identical sequences H0X8J0
ENSOGAP00000011819 ENSOGAP00000011819 XP_012663732.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]