SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011821 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011821
Domain Number 1 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 6.98e-47
Family GAF domain 0.0001
Further Details:      
 
Domain Number 2 Region: 597-710
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-44
Family PDEase 0.0001
Further Details:      
 
Domain Number 3 Region: 382-576
Classification Level Classification E-value
Superfamily GAF domain-like 7.85e-20
Family GAF domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011821   Gene: ENSOGAG00000013191   Transcript: ENSOGAT00000013196
Sequence length 710
Comment pep:known_by_projection scaffold:OtoGar3:GL873567.1:8412228:8723625:1 gene:ENSOGAG00000013191 transcript:ENSOGAT00000013196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASGLDFGEVETFLDRHPELFEDYLMRKGKQEMVQKWLQRHSQGQGASGPRAASGGTSS
SAHGTGRGGGSVGGGTGPNGAVNCQPAPSGMDCGAGPLSPSWAGGSRGDGSLQRKASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAMDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKSLVSKFFDVHAGTPLLPSSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTDDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESVEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEVRGALCLPLRGSIVKLTCRKGTSYRLTAVPDFADQSFSDA
AFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIPLVSELAI
DDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRH
AFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAK
Download sequence
Identical sequences H0X8J2
ENSOGAP00000011821 ENSOGAP00000011821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]