SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011851 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011851
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.15e-39
Family Second domain of FERM 0.000000627
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 4.84e-33
Family Moesin tail domain 0.0000226
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000793
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000011851
Domain Number - Region: 433-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00471
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011851   Gene: ENSOGAG00000013225   Transcript: ENSOGAT00000013230
Sequence length 583
Comment pep:known_by_projection scaffold:OtoGar3:GL873605.1:2162357:2206834:-1 gene:ENSOGAG00000013225 transcript:ENSOGAT00000013230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKKINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEVYCPPE
TAVLLASYAVQAKYGDYNKETHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTLK
AQKELEEQTRKALELDQERKRAKEEAERLEKERQAAEEAKSAIEKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENDHDEHDENNAEASAELLNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences H0X8M2
ENSOGAP00000011851 ENSOGAP00000011851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]