SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011855 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011855
Domain Number 1 Region: 22-200
Classification Level Classification E-value
Superfamily Lysozyme-like 2.81e-18
Family G-type lysozyme 0.0000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011855   Gene: ENSOGAG00000013231   Transcript: ENSOGAT00000013235
Sequence length 200
Comment pep:known_by_projection scaffold:OtoGar3:GL873598.1:8207161:8214647:1 gene:ENSOGAG00000013231 transcript:ENSOGAT00000013235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALWLLLGLLALTDSSESSNWGCYGNIRTLVTPGASCGIGRRHGLNYCGVRASERLAEI
DMPYLLKYQPMMQTVGQKYCMDPAVIAGLLSRESQGGNMLVNVGNVGNVGNGIKVVQDAD
FSTPMSWISESRVSQITETLTIRIKEIQRRFPAWTPDQHLRGGLCAYSGGAGYVRSSEDL
SCDFCNDVLARAKYLKRHGF
Download sequence
Identical sequences H0X8M6
ENSOGAP00000011855 XP_003794409.1.62490 ENSOGAP00000011855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]