SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011956 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011956
Domain Number 1 Region: 24-105
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000645
Family Snake venom toxins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011956   Gene: ENSOGAG00000013341   Transcript: ENSOGAT00000013343
Sequence length 136
Comment pep:known_by_projection scaffold:OtoGar3:GL873764.1:1725411:1726307:-1 gene:ENSOGAG00000013341 transcript:ENSOGAT00000013343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSVPSRMKVFLAVLLAGLLGMERAHSLVCFSCTNQNSNWYCLKPTVCSDADNYCVTVSAA
AGIGNVVDFGYTLNKGCSPICPGPSVNLGVASVGTRCCQSFLCNFSAADGGLRASTTLLG
LGLLLSLLPALLRPGP
Download sequence
Identical sequences H0X8W3
ENSOGAP00000011956 ENSOGAP00000011956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]