SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000011971 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000011971
Domain Number 1 Region: 484-835
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.73e-112
Family PDEase 0.000000241
Further Details:      
 
Domain Number 2 Region: 238-283,310-460
Classification Level Classification E-value
Superfamily GAF domain-like 5.07e-31
Family GAF domain 0.00087
Further Details:      
 
Domain Number 3 Region: 55-252
Classification Level Classification E-value
Superfamily GAF domain-like 1.7e-29
Family GAF domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000011971   Gene: ENSOGAG00000013355   Transcript: ENSOGAT00000013360
Sequence length 861
Comment pep:known_by_projection scaffold:OtoGar3:GL873527.1:38719643:38766464:1 gene:ENSOGAG00000013355 transcript:ENSOGAT00000013360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELSQASVEKYLEENPRFAKEYFDRKLRVEALGEIFKKSRVSIQASMSFPELTQVEESA
LCLELLQMVQEEVAGPELAAHRVLQRLAQLLQADRCSLFLCRARNGTPEVASRLLNVTPT
SKFEDNLVAPDREVVFPLDIGIVGWIAHTKKALNVLDVKKNSHFSDFMDKQTGYVTKNLL
AAPVTMGKEVLAVVMAVNKVHAPEFSKQDEEVFFKYLNFVAVILKLHHTNYLYSVESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSVGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREIIFYKIIDYILHGKEEIKVIPTPPADHWTLVSGLPTYVAENGFICN
MLNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATPDEIKSILKFKEKLNID
TIEDCEEKQLVKILEEDLPDPRAVELYEFRFSDFPLTEQGLIQCGLRLFFEINAVEKFKV
PVEVLTRWMYTVRKGYRSITYHNWRHGFNVGQTMFTLLTTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMETEEQAIKYVTIDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALLVASEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMMNGLQNNRMEWKSLADEYDAKIKALEEEVKKQEEGNMIE
KAAEDSGGGGDDKKSKTCLML
Download sequence
Identical sequences H0X8X8
XP_003783760.1.62490 ENSOGAP00000011971 ENSOGAP00000011971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]