SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012011 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000012011
Domain Number - Region: 48-125
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0135
Family Snake venom toxins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012011   Gene: ENSOGAG00000013405   Transcript: ENSOGAT00000013409
Sequence length 128
Comment pep:known_by_projection scaffold:OtoGar3:GL873616.1:43806:46820:1 gene:ENSOGAG00000013405 transcript:ENSOGAT00000013409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRSLMLGLPILLCCFTVLSGSLLHRDDTDNEIIVQEDNYYGQGLQIIQCRMCHLQFPGE
KCSRGRGICTATSQEACTVGRIFRKDGTPWLTFMGCLKNCATVKNINWGVYLVNFNCCRG
YDLCNEML
Download sequence
Identical sequences H0X912
ENSOGAP00000012011 ENSOGAP00000012011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]