SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012034 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012034
Domain Number 1 Region: 348-404,442-566
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000424
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 593-665
Classification Level Classification E-value
Superfamily EF-hand 0.0000744
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012034   Gene: ENSOGAG00000013430   Transcript: ENSOGAT00000013436
Sequence length 762
Comment pep:known_by_projection scaffold:OtoGar3:GL873540.1:20353592:20393433:1 gene:ENSOGAG00000013430 transcript:ENSOGAT00000013436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAVETPEGQELQNLGTGAWDNPAYSGPPSPHRALRIYTVSSAVPPQPQPKKPEDEPHEK
TRGTPVSSCCLHICHGIRGLWGTTLTENTAENRELYVKITLRELLVYVVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSETGVSFQAISSMADFWDFAQGPLLNSLYWTKWYNNQSL
GHGSHSFIYYENLLLGVPRLRQLRVRNDSCVVHEDFREDILSCYDVYSPDKEEQLPFGPL
NGTAWTYHSQDELGGSSHWGRLTSYSGGGYYLDLPGPRQASAEALRDLQEGLWLDRGTRV
VFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDIFIIICEIIFC
IFIFYYVVEEILELHIHRLHYLSSIWNILDLVVILLSIMAIGFHIFRTLEVNRLMGKLLQ
QPNMYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AVMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDDANRILGPAY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLSDLLRQGYNKTLLRLHLRKE
QVSDVQKVLQGGEQEIQFEDFTNTLRELGHAEHEITELTAAFTRFDRDGNCILDEKEQEQ
MQQDLEDKRVALNAEIENVGRSIASCLPGELGSEVARAGGWISGEEFYMLTRRVLQLETV
LEGLVSQVDSVGSKLTVLERKGWLTPSPGMEEQANWEHLQPA
Download sequence
Identical sequences H0X931
ENSOGAP00000012034 ENSOGAP00000012034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]