SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012084 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012084
Domain Number 1 Region: 289-416
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-41
Family Regulator of G-protein signaling, RGS 0.0000269
Further Details:      
 
Domain Number 2 Region: 3-96
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-25
Family DEP domain 0.016
Further Details:      
 
Domain Number 3 Region: 215-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 6.54e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012084   Gene: ENSOGAG00000013482   Transcript: ENSOGAT00000013489
Sequence length 437
Comment pep:known_by_projection scaffold:OtoGar3:GL873715.1:1904584:2070366:1 gene:ENSOGAG00000013482 transcript:ENSOGAT00000013489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDDKTGGVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIF
PISDHVLTMKDDGTFYRFQAPYFWPSNCWEPENTDYAIYLCKRTMQNKARLELADYEAEN
LARLQRAFARKWEFIFMQAEAQVKIDRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEM
DIRKCRRLKNPQKVKKSVYGVTEESQSQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRH
CLKMSKVAESLIAYTEQYVEYDPLITPAEPSNPWISDDVTLWDIEMSKEPSQQRVKRWGF
SFDEILQDQVGRDQFLRFLESEFSSENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPG
APSAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKK
KGPSHAGAQLSSLLQPS
Download sequence
Identical sequences H0X970
ENSOGAP00000012084 ENSOGAP00000012084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]