SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012138 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012138
Domain Number 1 Region: 29-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.08e-30
Family Ankyrin repeat 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000012138
Domain Number - Region: 395-583
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00942
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012138   Gene: ENSOGAG00000013542   Transcript: ENSOGAT00000013548
Sequence length 728
Comment pep:known_by_projection scaffold:OtoGar3:GL873568.1:2387242:2401635:1 gene:ENSOGAG00000013542 transcript:ENSOGAT00000013548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSLPKEKGLILCLWSKFCRWFQRQESWAQSRDEQNLLQQKRIWESPFLLAAKENDVQA
LHKMLKYNACEVHQREMIGAMGETALHVAALYDNVEAAIVLIEAAPELVFEPMTSELYEG
QTALHIAVVNQNVNLVRALLNHGASVSARATGTAFRRSPRNLIYFGEHPLSFAACVGSEE
IVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQMYNLLLSYDGRGDHLQPLDTVPN
HQGLTPFKLSGVEGNTVMFQHLMQKRKHIQWTYGPLTSTLYDLTEIDSSGCEQSLLELIV
TTKKREARQILDQTPVKELVSLKWRRYGRPYLCVLGAIYLLYIICFTMCCVYRPLKSRTT
NRTSTRDNTLLQQKLLQEAYVTPMDDIRLVGELVTILGALIILLIEIPDIFKMGVTRFFG
QTILGGPFHVLIITYALLVLVTMVMRITNTNGEVVPMSLALVLGWCNVMYFARGFQMLGP
FTIMIQKMIFGDLMRFCWLMAVVILGFASAFYVIFQTEDPTELGHFYDYPMALYSTFELF
LTIIDGPANYSVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQV
VATTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDLNRQRIQRYAKAFHTLGSE
DSDKDSVDKLDLGRPSSPHLSLSIPSVSRSTSRSSINWERLRQGTLRKDLRGLVNRGLED
GDSWEYQI
Download sequence
Identical sequences H0X9B3
ENSOGAP00000012138 ENSOGAP00000012138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]