SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012192 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012192
Domain Number 1 Region: 23-358
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.31e-109
Family Phosphofructokinase 0.000000283
Further Details:      
 
Domain Number 2 Region: 349-771
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.45e-106
Family Phosphofructokinase 0.0000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012192   Gene: ENSOGAG00000013606   Transcript: ENSOGAT00000013611
Sequence length 787
Comment pep:known_by_projection scaffold:OtoGar3:GL873538.1:25970060:26014909:-1 gene:ENSOGAG00000013606 transcript:ENSOGAT00000013611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDVPSSRKGSLRKILEPLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFI
YEGYQGMVDGGKNIVEANWESVSNILQVGGTIIGSARCKAFRTREGRLKAAYNLTQVGIT
NLCVIGGDGSLTGANIFRKEWMELLEELVRNGQIEEKAMQKYAHLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPQEGWEQLLCEKLSENRARKKRLNIIIVAEGAIDTKNNAITSEKVKELVVKQLGYDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPEVPACVVSLSGNHAVRLPLVEC
VQMTQDVQKAMNEGRFKDAVQLRGRSFQNNLNTYKRLAMKLPDDEIQKSNCNVAVINVGA
PAAGMNAAVRAAVRVGIADGHRMLAVYDGFDGLAKGQIKEIGWSDVGGWTGQGGSILGTK
RVLPGKFLDKIAEQMRSHSIHALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVS
NNVPGSDFSIGADTALNTVTDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEPFDIRDLQTNVEHLTEKMKTSIQRGLVLRNENCCVNYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGTPSPFDRNFGTKISARAMEWLTLLVSCSPTPRKKFYSNDSVCVL
GISKRNVLFQPVADLKEETDFEHRIPKEQWWLKLRPLMKILAKYQATYDVSDAGQLEHVQ
RIETTAI
Download sequence
Identical sequences H0X9F9
ENSOGAP00000012192 ENSOGAP00000012192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]