SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012207 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012207
Domain Number 1 Region: 211-497
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-38
Family Kelch motif 0.0034
Further Details:      
 
Domain Number 2 Region: 1505-1721
Classification Level Classification E-value
Superfamily Kelch motif 4.05e-30
Family Kelch motif 0.02
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1782-1873
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000262
Family Kelch motif 0.016
Further Details:      
 
Domain Number 5 Region: 1212-1260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 6 Region: 1075-1110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000226
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 7 Region: 1164-1212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000352
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000012207
Domain Number - Region: 2256-2306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 2184-2219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000412
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 2531-2541
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 2350-2385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family Laminin-type module 0.023
Further Details:      
 
Domain Number - Region: 1298-1402
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00916
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012207   Gene: ENSOGAG00000013619   Transcript: ENSOGAT00000013627
Sequence length 2848
Comment pep:known_by_projection scaffold:OtoGar3:GL873671.1:625285:669849:1 gene:ENSOGAG00000013619 transcript:ENSOGAT00000013627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSMALVEALATTLALAVLGSLSPGIQAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCQGHGQCRPPGVCACEPGWGGPDCSLQECSAYCGS
HGTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPPG
LLAVFGGQDLNNALGDLVLYNFSTNTWESWDLRPAPAARHSHVAVAWAGSLVLMGGELAD
GSLTNDVWAFSPLGRGHWELLAPPASSSWGPPGLAGHAAALVDDIWLYVSGGRTQHDLFS
SGLFRFHLDSTSGGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRV
NSTELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGERPAGTSLRRQAWDGMGGSLEVLDLGSIPGFAMGK
MTGNKQPTVQKPSSQLVQVQWCLQLIDHSQLQIPLACQSWCQGACQAAPPPGTPSGACPA
ASCLGLGRLLGDCQACLAFSSPTAPPRGPGALGWCVHNESCLPRPEQARCRGEQISGTVG
WWGPVPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDKVSIVRSTTITLTPSAETDVS
LVYRGFIHPLLPGGPAGPGAEDVAVWARAQRLHVLARMACGPDTDNMEEVGRWVAQQEKE
TRRLQCPGSARLFPLLGRDHKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFF
LEPYRSSACASYSSCLGCLADQGCGWCLTSATCHLRQGGTHCEDDGATGSLLVLVPALCP
LCEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGRGALKSPEECPPLCSQRLTCDDC
LANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDGFLTCHECLQSH
ECGWCGNEDNPTLGRCLQGDFSGPLSGGNCSLWVGEGLGLPVALPARWAYARCPDVDECR
LGLARCHPRATCLNTPLSYECHCQRGYQGDGITHCNRTCMEDCGHGVCSGPPDFTCVCDL
GWTSDLPPPTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSF
GNATGSGGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSC
FRECGGRTLLTNVSSVALGSRRVGGLLPPGGRTSRAGPGLSYCVWVVSATELLQPCAPGT
LCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQQRDRPLTVQA
LSGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGTGLCRCPQGW
AGPHCRMALCPENCNAHTGAGTCNQSLGICICAEGFGGPDCATKLDGGQLVWETLMDSRL
SADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDG
GPGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQTVELPA
VAGHTLTARRGLSLLLVGGYSPENGFNQQLLEYHLMTGTWVSGVQSGTPPTGLYGHSAVY
HEATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGSKVRKRECGVFISRGL
GQVPMGQPGTWGFQELGGRRWLAALGDTGGLLEEGHFGHMFPQQPHHRLFHAAALLGDTM
VVLGGRSDTDEFSSDVLLYQVNCNAWLLPDLTRLASVGAPMEESVAHAVAAVGSRLYISG
GFGGVALGRLLALTLPPDPCRLLSSSEACNQSGACTWCHGACLSGDQAHRLGCGATPCSP
MPRSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNCPEGACIGRNGSCTSEND
CRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCF
SHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPSY
LQLRCMAGGCGRLLQGPESCSLGCAQATQCALCLRRPHCGWCAWGGQDGSGRCMEGGLSG
PRDGLTCGRPGTSWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNVTG
LCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNHT
KGSHCEQCLPLFVGSAVGGGTCRPCHAFCRGNSHICVSRKELEMAKKEPEKYSLDPEEIE
NWVTEGPSEDEAVCVNCQNNSYGDKCESCLHGYFLLDGKCTKCQCNGHADTCNEQDGTGC
PCQNNTETGTCQGSSPSDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTS
QTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAP
DTGVHTVHIQPPPPPPPPPPPADGGPRGAGDPGGPGAGSGLGTLVEPRVREVWPRGLITY
VTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLL
FFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRPF
AKVTVCFPPDPTAPAPAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPMGGGCCPPAIP
ATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGGS
GGAGGSGHGAGAGRKGLLSQDNLTSMSL
Download sequence
Identical sequences H0X9H2
ENSOGAP00000012207 ENSOGAP00000012207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]