SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012213 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000012213
Domain Number - Region: 96-133,170-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0698
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012213   Gene: ENSOGAG00000013634   Transcript: ENSOGAT00000013633
Sequence length 323
Comment pep:known_by_projection scaffold:OtoGar3:GL873537.1:14218449:14272382:1 gene:ENSOGAG00000013634 transcript:ENSOGAT00000013633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHS
GLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLLGGLC
IGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYNYGWS
FYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRRRRSR
SSSRSTEASPSRDASPVGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEAGFLQVH
DFFPQDLKESFHVSMLNRRTTPV
Download sequence
Identical sequences H0X9H7
ENSOGAP00000012213 ENSOGAP00000012213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]