SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012242 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012242
Domain Number 1 Region: 632-700,936-1272
Classification Level Classification E-value
Superfamily Ras GEF 6.54e-119
Family Ras GEF 0.0000103
Further Details:      
 
Domain Number 2 Region: 222-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-19
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 432-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000059
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012242   Gene: ENSOGAG00000013664   Transcript: ENSOGAT00000013671
Sequence length 1275
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:30738692:30853677:-1 gene:ENSOGAG00000013664 transcript:ENSOGAT00000013671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEDPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKKKERKKERKKERKRQSDASLYCDDVDIRFSKTMNSCKVLQIRYASVGRLLE
RLTDLRFLSIDFLNTFLHSYRVFTTAVVVLDKLITIYKKPISAIPARWVGSLELLFASGQ
NNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCN
SNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDMTPEKPEDPSTLSKQSSEVSV
REESDIDQNQSDDGDTEMSPTKSPTTPKSVKCKNSSEFPLFSYNNGVVMTSCRELDSNRS
ALSAASAFAIATAGANEGTPNKEKYRRMSLASTGFPPDQRNGDKEFVIRRAATNRVLNVL
RHWVSKHSQDFETNEELKCKAVSFLEEVVHDPELLTQERKAAANIIRTLTQEDPGDNQIT
LEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPY
IMKTTKHFNDISNLIASEIIRNEDINARVSTIEKWVAVADICRCLHNYNAVLEITSSMNR
SAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLA
FIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEE
SLYESSLRIEPKLPT
Download sequence
Identical sequences H0X9K0
ENSOGAP00000012242 ENSOGAP00000012242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]