SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012249 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOGAP00000012249
Domain Number - Region: 506-573,1116-1187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0126
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012249   Gene: ENSOGAG00000013674   Transcript: ENSOGAT00000013678
Sequence length 1202
Comment pep:known_by_projection scaffold:OtoGar3:GL873530.1:18002178:18029703:1 gene:ENSOGAG00000013674 transcript:ENSOGAT00000013678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLIRMGSQERRLLRPKRLHWSRFVFLLGILIISSTYQHLRRPRGLSSLWTEVSLQQPV
KLASRDLPSDEMMMVSSDPPKASPVTESEMLVPQAMVGRDEGTPSITMENAPNIPRGTAE
ITTATIKNNYSPKAVGTERVKENTPTTSSRILNHYTPTSSRQKVKYYTPMPRGEMKSHSP
TKGRRKVKKYTPSPPETSHTTTPSSTVKDSETTATYKMLKTNSPKRIVEEATQTTLKGIV
GNTPTSLTHEVETNILTSPRNAVEKSTLTIPRRVESNSSTSPWRTILEHTPAVPEGQVTG
SSPAETKTSTTAQSIKNPLPRTSASTIRTAPATVGRLAKKAPTVPSTSATLKVRAAPTTQ
VHHCMVVKPAPAMPITPSLSLTTALLPEVPSPSVLPPSWSDIYPKAEYPPDLFSVEERRQ
GWVVLHIFGMMYVFVALAIVCDEYFVPALGVITDKLQISEDVAGATFMAAGGSAPELFTS
LIGVFISHSNVGIGTIVGSAVFNILFVIGTCALFSREILNLTWWPLFRDVSFYILDLMML
IVFFLDSLIAWWESLLLLLAYGLYVFAMKWNRKIERWVKEQLSRRPAAKVMALEDLNKPG
DGAIAEDDLQDNKKLKLPSLLTRGSSSASLHNSTIRSTIYQLMLHSLDPLGEARPSKDKE
EESLNQEARAQPQAKAENKPEGLSFKEEPAELPAVMVTPAPAPDVEGDQEEDPAGQGDEA
GAENPGEMTGEEGETLCEAEGKGVNESEGEIEAEEGKEDEHEGESEAEGKGKDEHEGEIE
AEGKGVDKSEGEIEVEEGKENECEGVIEAEGKGVNESEGESEAEEGKEDEHEGETEAEGK
GVNESEGEIEAEEGKEDEHGGEIEAEEEGKGDELEGESEAEGKGDELEGESEAEGKGDEG
ESEAEGKGDELGGETEAEGKGEKESEGEIQAGENGEIIDAEDETEDQKCNAENQDEAKNN
EKGDGEGGSDGGDSEEEEEEEEDEDEDEEEEEEGGNEEPLSLDWPETRQKQAIYLFLLPI
VFPLWLTVPDVRRQESRKFFVITFLGSIIWIAMFSYLMVWWAHQVGETIGISEEIMGLTI
LAAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPVPWLLFSLINKLQPVPVS
SNGLFCAIVLLFLMLLFVISSIASCKWRMNKILGFTMFLLYFIFLIISVMLEDRIISCPV
TV
Download sequence
Identical sequences H0X9K5
ENSOGAP00000012249 ENSOGAP00000012249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]