SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012279 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012279
Domain Number 1 Region: 44-149,292-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.19e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0059
Further Details:      
 
Domain Number 2 Region: 156-219
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000142
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012279   Gene: ENSOGAG00000013707   Transcript: ENSOGAT00000013710
Sequence length 432
Comment pep:novel scaffold:OtoGar3:GL873569.1:12031278:12057316:1 gene:ENSOGAG00000013707 transcript:ENSOGAT00000013710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPLVALVSGPHARLFACFLRLGSQQASPLQLHTGSSCSAKNYYEVLVLGGGSGGITMAA
RVKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKPLSLSGRPTASVIPSGVEWIKDRVVE
LNPDKNCIYTDNGKQISYKYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWR
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAHFRKNIKYPKKSCSFLHIRLSTQVQG
YKYLLTLDTHFANRQIPILKAXNCVLGKAAVEEAVFKHLSPVHTIIVNYGMLHVTPPMSP
PDVLKTSPVADAAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPVKKYDGYTSCPLVTGYNRVILAEFDYKAQPLETFPFDQSKERLSMYLMKAD
LMPFLYWNMMLR
Download sequence
Identical sequences H0X9M9
ENSOGAP00000012279 ENSOGAP00000012279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]