SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012380 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012380
Domain Number 1 Region: 218-276
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000419
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012380   Gene: ENSOGAG00000013819   Transcript: ENSOGAT00000013823
Sequence length 321
Comment pep:known_by_projection scaffold:OtoGar3:GL873542.1:21767247:21781731:-1 gene:ENSOGAG00000013819 transcript:ENSOGAT00000013823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVRVRLEDRFNSVAAEPPAAARGPEPPEPGVALNNLVTLIRHPSELMNVPLHQQQNKCTT
LVKNKTAAATTALQFTYPLFTTNACSTGGNSNLSQTQSSGNSCSILEAAKHQDIGLPRAF
SFCYQQEIESTKQTLGSRNKALPEQVWIKVGEEALCKQAINKRNRSRIRQLDTNVERRAL
GEIQNVGEGSTAAQGAWQSSESSQSNLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRIC
CDELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRP
DSLVTCPTQGSLQSSPAMEIK
Download sequence
Identical sequences H0X9W2
ENSOGAP00000012380 ENSOGAP00000012380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]