SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012472 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012472
Domain Number 1 Region: 101-246
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-27
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 4-33,73-131
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-18
Family Voltage-gated potassium channels 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012472   Gene: ENSOGAG00000013929   Transcript: ENSOGAT00000013932
Sequence length 378
Comment pep:known_by_projection scaffold:OtoGar3:GL873581.1:1835565:1884238:1 gene:ENSOGAG00000013929 transcript:ENSOGAT00000013932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLSLIICTFTYLLVGAAVFDALESDHEMREEEKLKAEETRIRGKYNISTEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQSKGALQRKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNGDEEEQDLEGRAALPEGNGERPGGRGRRERRSARSRYKANIADLLSVCTC
SCYRPRDAGGDPPEEVEVPQNSNSAKPPNSLQPISFQMEEISPSTLKHGLFPSPISSVSP
GLHSFNDHNRLMRRRKSI
Download sequence
Identical sequences H0XA45
ENSOGAP00000012472 XP_003792904.1.62490 ENSOGAP00000012472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]