SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012526 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012526
Domain Number 1 Region: 390-488
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012526   Gene: ENSOGAG00000013990   Transcript: ENSOGAT00000013994
Sequence length 489
Comment pep:known_by_projection scaffold:OtoGar3:GL873578.1:4481140:4504641:1 gene:ENSOGAG00000013990 transcript:ENSOGAT00000013994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAWCVSDAKPEKKHGVRCSIAVMFTYLILLTAGAGILVIQVLNLQERLQALEMHFPNGT
LATEHKPFFLLQWGRPSSHPGLQVLQAQLAQVRMSQEHLSQQVDNFTRNPELFGIKGERG
ATGPPGQKGAPGLPGTPGLPGPPAEKGAKGATGRDGATGPPGPQGPPGIKGEAGPHGPQG
TPGKQGAPGTPGPQGEKGSKGDGGLIGPKGAPGIKGDKGDLGLPGNKGDVGMKGDRGVMG
PPGAQGSKGDSGKPGPPGLLGSPGVKGDQGQPGAQGVPGLPGASGPPGAKGEPGSTGLRG
LTGLPGIPGSPGVSGMKGDKGNPGFQGQKGTKGEPGVPGLAGTKGERGQPGLAGPMGAPG
PAGQKGNPGLKGSPGLQGVKGEKGEKGESPVSVRIVGGSVRGRAEVYYNSTWGTICDDGW
DNLDATVFCRMLGYSRGRAITRQGAGTGQIWLDDVACQGTESTLWSCRKNSWGSHNCVHE
EDAGVECSI
Download sequence
Identical sequences H0XA92
ENSOGAP00000012526 ENSOGAP00000012526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]