SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012545 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012545
Domain Number 1 Region: 96-156
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.31e-16
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012545   Gene: ENSOGAG00000014012   Transcript: ENSOGAT00000014015
Sequence length 180
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:38254586:38255128:-1 gene:ENSOGAG00000014012 transcript:ENSOGAT00000014015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDNRNNSNLPDKRPVFSDSAHLPLTRSFYLDPMVTFHLYQEAPVPSPYSEELPLLPFPN
DSLIMDNYSEPCPISFPMPYPNYRRCDYSCGPAFIRKRNERERQRVKCVNEGYAQLRHHL
PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKGSSTMAATSHQDPIFRIV
Download sequence
Identical sequences H0XAA9
ENSOGAP00000012545 XP_003781131.1.62490 ENSOGAP00000012545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]