SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012579 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012579
Domain Number 1 Region: 48-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000129
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000811
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 
Domain Number 3 Region: 171-260
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000406
Family Spermadhesin, CUB domain 0.0091
Further Details:      
 
Domain Number 4 Region: 281-389
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000068
Family Spermadhesin, CUB domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012579   Gene: ENSOGAG00000014043   Transcript: ENSOGAT00000014050
Sequence length 413
Comment pep:known_by_projection scaffold:OtoGar3:GL873606.1:2662275:2666426:1 gene:ENSOGAG00000014043 transcript:ENSOGAT00000014050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLGPCSASCGLGTARRSVACMQFDQGRDTEVDEAACAALVRPQASVPCLIDDCAYQWHV
SSWTECSVSCGDGIQHRQSTCLGPQAGAPVPANFCEHRPKPVTVRGCWAGPCAEQGTPSP
VPHEEATALGQTTVAPPAVSLEGPQPHARLLSPTSQTLGFLPRPQERTAQPRLRSACGGQ
HLEPTGIIDMRGWGQADCAVAIGRPLGEVVTVQVLESSLNCSTGEMLLFWGRLTWEESCT
RQAGETFSPNTNTLVVRQRRKRRVGGVVLRYWSWPAAGMVHRECDRQLFGPRGEIMSPLL
SPDRRNTGGCRIFIDVAPQARIAIHALAMAMDTGTKGANAGYILIRETHSLRTTTFHGQV
LYWESEGSQAEMEFSEGFLEAQASLRGHYWTLPSREQEEDKKQEPGWKGKEGT
Download sequence
Identical sequences H0XAD8
ENSOGAP00000012579 ENSOGAP00000012579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]