SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012590 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012590
Domain Number 1 Region: 20-139,215-320
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.1e-64
Family FabD-like 0.0000965
Further Details:      
 
Domain Number 2 Region: 147-222
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000405
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012590   Gene: ENSOGAG00000014060   Transcript: ENSOGAT00000014061
Sequence length 337
Comment pep:known_by_projection scaffold:OtoGar3:GL873526.1:5577003:5587880:1 gene:ENSOGAG00000014060 transcript:ENSOGAT00000014061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEEEPVPATTRRMPDQCSVLLFPGQGSQVVGMGRGLLAYPRVRELYAAAHRVLGYDLLE
LSLHGPQEALDRTAYCQPAIFVASLAAVEKLHHLQPAVIENCVAAAGFSVGEFAALVFAG
AMDFSEGLYAVKIRAEAMQEASEAVPSGMLSVLGKPQSKFNSACLEAREHCKSLGIENPV
CEVSNYLFPDCRVISGHLEALQFLQKNSSKFHFRRTKMLPVSGGFHTRLMEPALEPLEQV
LKTITIKEPLISVHSNINGNRYMHPKHIQKLLAQQVVSPVKWEQTMHAIYERKKGTAFPQ
TFEVGPGQQLGTILKSCNLQAWKSYSHVDVLQATKDP
Download sequence
Identical sequences H0XAE8
ENSOGAP00000012590 ENSOGAP00000012590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]