SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012612 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012612
Domain Number 1 Region: 4-36,86-145
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-16
Family Voltage-gated potassium channels 0.005
Further Details:      
 
Domain Number 2 Region: 168-263
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000549
Family Voltage-gated potassium channels 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012612   Gene: ENSOGAG00000014083   Transcript: ENSOGAT00000014084
Sequence length 307
Comment pep:known_by_projection scaffold:OtoGar3:GL873659.1:2491768:2494556:-1 gene:ENSOGAG00000014083 transcript:ENSOGAT00000014084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLRPWARYGLLVVGHLLALGVGAMVLQALEGPPALRLQAELRAELAIFQAKHGACLAP
GALKELLGAALEAQTHGVSTLDNSSKDRNWDLPSALLFTASILTTTGYGHMAPLSTGGKA
FCVVYAALGLPASLALVATLRHCLLPVLSRPGAWVAVHWQLAPNRVVLLQAVGLGLLVAG
IFMLLPAIVLWGVQEDCSLLEAIYFCFSSLSTIGLGDLLPSHGQGLHPAIYHLGQLALLG
YLLLGLLALLLAVETFSELPQVRAMKKFFRCSGPFTAEDQGGILVQDELALSTLPPTALA
SEQAPAC
Download sequence
Identical sequences H0XAG8
ENSOGAP00000012612 XP_003798709.1.62490 ENSOGAP00000012612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]