SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012783 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012783
Domain Number 1 Region: 2743-3003
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-69
Family Protein kinases, catalytic subunit 0.0000024
Further Details:      
 
Domain Number 2 Region: 1918-2114
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-54
Family DBL homology domain (DH-domain) 0.0000131
Further Details:      
 
Domain Number 3 Region: 1253-1431
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 4 Region: 2116-2238
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-32
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 
Domain Number 5 Region: 1435-1553
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-32
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 6 Region: 2635-2731
Classification Level Classification E-value
Superfamily Immunoglobulin 1.74e-21
Family I set domains 0.008
Further Details:      
 
Domain Number 7 Region: 270-406
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1067-1204
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 817-970
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-19
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 491-632
Classification Level Classification E-value
Superfamily Spectrin repeat 2.37e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2500-2564
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000955
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1604-1695
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000194
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 26-180
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000017
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 637-744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000864
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 15 Region: 184-300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000445
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000012783
Domain Number - Region: 411-523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0767
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012783   Gene: ENSOGAG00000014252   Transcript: ENSOGAT00000014267
Sequence length 3051
Comment pep:known_by_projection scaffold:OtoGar3:GL873552.1:11450524:11684666:-1 gene:ENSOGAG00000014252 transcript:ENSOGAT00000014267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATQVTHFIFFFISGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRI
RQEDLRRLISYLACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALII
KPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVA
FEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEG
QKLLQRIQSSDSFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQC
FQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNIN
RIMSVANRLVESGHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMS
NVDSWCKACGEVDLPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPG
SSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVL
DWIENHGEAFLSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGE
CDPEEIYQAAHQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVY
AESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSISHIET
VLQQLDEAQSQMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTE
DLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQ
DLLEFLHEKQQELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASS
LQEAEQLQREHEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQL
MLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPM
ISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQR
ENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELL
KEHEEFQITAKQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYR
TSLEKALGISSDSNKSSKSLQLDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAE
LIQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKEL
EKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSIS
SYLIKPVQRITKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDEN
IESQGELILQESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFT
SELGVTEHVEGDPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKG
ALKEPIHIPKTAPAARQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCE
LTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIA
HSRSSMEMEGIFNHKDSLSVSSNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTS
PVRRLSSGKADGHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGL
SSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPT
SSETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEM
EERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMKEDGVPDDMKGKDKIVFGNI
HQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTF
FEDLKQRLGHRLQLTDLLIKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVP
RRCNDMMNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDAGLLPRCKERRIFLFEQIVIFSE
PLDKKKGFSMPGFLFKNSIKVSCLCLEENVENDPCKFALTSRTGDVVETFILHSSSPSVR
QTWIYEINQILENQRNFLNALTSPIEYQRNHSGGGSGGSGGGGSSGAPSCGGGHSGGPSG
GGSSVPSSSRSRPSRIPQPVRHHPPVLVSSAAPSQAEADKMSGTCTPGPSLPLPSSSLAL
EAGLSQPSRPPPSGDTEGAERGADPIPKMKVMDSPRKSANQDASAKDARGGPGSLPLGKP
RSGAVSPLNSPLATVFPSPFGKEPFPPSSPLQKGGSFWSSIPASPASRPGSFTFPGDSDS
LQRQTHRHTAPSKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKED
EINVYQGEVVQILASNQQNMFLVFRAATDQCPAAEGWIPGFVLGHTSAVIMENPDGTLKK
STSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPEFV
IPLSEVTCETGETVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEAALKIVG
VTTDDDGIYTCIAVNDMGSASSAASLRVLGPGSDGIVVTWKDNFDSFYSEVAELGRGRFS
VVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQNLQHPLLVGLLDTFETPTSYVLV
LEMADQGRLLDCVVRWGSLTEGKIRAHLGEVLEAIRYLHNCRIAHLDLKPENILVDQSLA
KPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVLLSG
VSPFLDDSVEETCLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQ
WLQVGTSTGKSTDVLDTSRLTSFIERRKHQNDVRPIRSIKNFLQSRLLPRV
Download sequence
Identical sequences H0XAV6
ENSOGAP00000012783 ENSOGAP00000012783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]