SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012798 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012798
Domain Number 1 Region: 565-1039
Classification Level Classification E-value
Superfamily Ras GEF 7.19e-136
Family Ras GEF 0.000000000000252
Further Details:      
 
Domain Number 2 Region: 7-177
Classification Level Classification E-value
Superfamily Histone-fold 2.62e-51
Family TBP-associated factors, TAFs 0.000000289
Further Details:      
 
Domain Number 3 Region: 207-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-40
Family DBL homology domain (DH-domain) 0.000000192
Further Details:      
 
Domain Number 4 Region: 416-572
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-37
Family Pleckstrin-homology domain (PH domain) 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012798   Gene: ENSOGAG00000014279   Transcript: ENSOGAT00000014285
Sequence length 1332
Comment pep:known_by_projection scaffold:OtoGar3:GL873573.1:4663479:4747653:1 gene:ENSOGAG00000014279 transcript:ENSOGAT00000014285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLISLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDKKLFRPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALLNLQGSMDRIYRQYAPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEIRRFFENLNPMGNASEKEFTDYLFNKSQEIEPRNCK
QPPRFPRKTTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESAA
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGNLHKLS
EETLIPPPLPPRKKFDHDASNSKGNTISDDDPPAIPPRQPPPPKVKPRVPVPAGAFDGPL
HSPPPPPPRDPLPDTPPPIPLRPPEHFINCPFNLQPPPLGHLHRDPDWFRDVSTCPNSPS
TPPSTPSPRVPRRCHMLSSSHNNLAHPPAPPVPPRQSSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
Download sequence
Identical sequences H0XAX0
ENSOGAP00000012798 ENSOGAP00000012798 XP_003792205.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]