SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012802 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012802
Domain Number 1 Region: 47-274,307-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.61e-41
Family FAD-linked reductases, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012802   Gene: ENSOGAG00000014286   Transcript: ENSOGAT00000014289
Sequence length 461
Comment pep:known_by_projection scaffold:OtoGar3:GL873573.1:4621009:4650732:1 gene:ENSOGAG00000014286 transcript:ENSOGAT00000014289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGLRYLRVASVRARRGLLEACGPALRRPGSLRVSGRGTSTSTSSFDVVIVGGGIVGLA
SARALILRHPALSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALLYE
YCNQKGISYKQCGKLIVAVEQEEIPRLQALYERGLQNGVQGLRLIQQEDIKKKEPYCRGL
MAIDCPYTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKDIEMAKESPSRSKDGMKYPILI
KNTKGEEIQCQYVVTCAGLYSDRISEMSGCSPDPQIVPFRGDYLLLKPEKCYLVKGNIYP
VPDSRFPFLGVHFTPKMDGNIWLGPNAVLAFKREGYRPFDFNARDVMDIIINSGLIKLAS
QNFSYGVNEMYKACFLGATVKYLQKFIPEITVSDILRGPAGVRAQALDRAGNLVEDFVFD
GGVGDLGNRILHVRNAPSPAATSSIAISEMIADEVQQRFEL
Download sequence
Identical sequences H0XAX4
ENSOGAP00000012802 ENSOGAP00000012802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]