SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012806 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012806
Domain Number 1 Region: 115-191
Classification Level Classification E-value
Superfamily RNI-like 0.000000147
Family 28-residue LRR 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012806   Gene: ENSOGAG00000014289   Transcript: ENSOGAT00000014293
Sequence length 217
Comment pep:known_by_projection scaffold:OtoGar3:GL873573.1:4609898:4614287:-1 gene:ENSOGAG00000014289 transcript:ENSOGAT00000014293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCCGVSTASLVIVCLDQMMLFGKVSWQLCGLKKLPWSCDSRYFWGWLNTVFNKVDYERIR
DVGPDRAASEWLLRCGAMVRYHGQERWQKDYNQLPTGPLDKYKIQAIDATDSCIMSIGFD
HMEGLEHVEKIKLCKCHYIEDECLQRLSQFEKLQKSILEMEIISCGNITDKGIIALRHLR
NLKYLLLSDLPRIREKEKLIQALKIALPSLELKSSLK
Download sequence
Identical sequences H0XAX8
ENSOGAP00000012806 ENSOGAP00000012806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]