SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012815 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012815
Domain Number 1 Region: 806-1062
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.85e-89
Family Eukaryotic proteases 0.0000000696
Further Details:      
 
Domain Number 2 Region: 389-547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-38
Family MAM domain 0.0073
Further Details:      
 
Domain Number 3 Region: 564-676
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 269-379
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-19
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 5 Region: 59-165
Classification Level Classification E-value
Superfamily SEA domain 1.31e-18
Family SEA domain 0.0071
Further Details:      
 
Domain Number 6 Region: 717-817
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000863
Family Scavenger receptor cysteine-rich (SRCR) domain 0.026
Further Details:      
 
Domain Number 7 Region: 683-721
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 226-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012815   Gene: ENSOGAG00000014298   Transcript: ENSOGAT00000014303
Sequence length 1063
Comment pep:known_by_projection scaffold:OtoGar3:GL873528.1:17059616:17186351:1 gene:ENSOGAG00000014298 transcript:ENSOGAT00000014303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRRSVSSRNHSFSAYEIVVGVLFAILVVVCAGLTAISWLAIKEAERDAAFGQSHEARG
TFKITSGATYNPNLQDERSVDFKVLAFDLQQMIDDIFQSSNLKNEYKNSRVLQFENGSVV
VIFDLFFARWVSNENVKEELIQGIEANKSSQLVTFHIDLNSIDISASLENFSTMSPATTS
DKLTSSRLLATPDFLGKRNTRAKINSKASLSNVKCLEFYYLLGNVSMECLPGSRPCADAV
TCIAIDLFCDGELNCPDGSDEDNQICATDCDGKFLLTGSSGSFQAAHYPKPSNPNIVCQW
IISVNQGLSVKLSIDSFNTYNPDILNIYEGVGSSKILRASLWETNPGTIRIFSNQVTVTF
LIESDENYYVGFNATYTTFNSSELNNYEKIDCNFEDGFCFWVQDLNDDNGWERIQGNTFP
PLTGPNFDHTFGNISGFYISTPTGPGGRQERVELRSLPLDPTSEPVCLSFWYYMYGENVY
KLSINISSGQNMEKTIFQREGNYGENWNYGQVTLNETVEFKVAFNAFKNRVLSDIALDDI
SLTSGMCNESLYPEPTPLPELPTDCGGPFELWEPNTTFSSTNFPNGYPNGAFCVWNLNAQ
KGKNIQLHFQEFDLENVADVVEIRDGGEDGSVLLETAVYTGPGPVKDVFSTTSRMTVLLI
TDQTLARGGFKANFTTGYHLGSPEPCKEDNFQCADGECVPLANLCDGHPHCKDGSDEAHC
VFFINGTTSKAGLVQFRIQSIWHTACAENWTAQISNDVCQLMGLGSGNSSMPISSTQSGP
FVKLSTAADGSLTLTPSQQCLQNSLILLQCNPKSCGKKMLAQEVTPKIVGGNNAKEGAWP
WLAALYYNNQLLCGASLVSRDWLVSAAHCVYGKNMKPSQWTAILGLHMTSNLTSPQTAAV
LIDQIVISPHYNKRTKDNDIAMMHLEVQVNYTDYIQPICLPEENQAFPPGRMCFIAGWGF
LKLNKCPTANILQEAEVPLLSNEKCQQQMQEYNITENMICAGYEEGGTDTCQGDSGGPLM
CQENNRWFLAGVTSFGYQCALPHRPGVYVRVPRFTEWIQSFLH
Download sequence
Identical sequences H0XAY4
ENSOGAP00000012815 ENSOGAP00000012815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]