SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012830 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012830
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.49e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 5-81
Classification Level Classification E-value
Superfamily F-box domain 4.19e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSOGAP00000012830
Domain Number - Region: 416-449
Classification Level Classification E-value
Superfamily ARM repeat 0.0155
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012830   Gene: ENSOGAG00000014318   Transcript: ENSOGAT00000014322
Sequence length 468
Comment pep:known_by_projection scaffold:OtoGar3:GL873520.1:60644841:60683433:-1 gene:ENSOGAG00000014318 transcript:ENSOGAT00000014322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMEAEATPLTLGSLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQQDQCWKSLFIDTYSDVGRYINHYAAIKKAWDNLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
TGATFTDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences H0XAZ3
ENSOGAP00000012830 ENSOGAP00000012830 XP_003781267.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]