SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000012913 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000012913
Domain Number 1 Region: 440-666
Classification Level Classification E-value
Superfamily RNI-like 1.18e-29
Family Cyclin A/CDK2-associated p19, Skp2 0.038
Further Details:      
 
Domain Number 2 Region: 81-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000403
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000012913   Gene: ENSOGAG00000014408   Transcript: ENSOGAT00000014413
Sequence length 694
Comment pep:known_by_projection scaffold:OtoGar3:GL873615.1:7721287:7741705:1 gene:ENSOGAG00000014408 transcript:ENSOGAT00000014413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEVPEKGETGPSALLTPPMSSSSRGPGAGARRRRTRCRRCRACVRTECGDCHFCRDMK
KFGGPGRMKQSCLLRQCTAPVLPHTAVCLLCGEAGKEDTVEGEEEKFGLSLMECTICNEI
VHPGCLKMGKAEGVINAEIPNCWECPRCTQEGRTSKDSGEGPGRRRADNGEEGASLGSGW
KLTEEPQLPPPPPRRKGPLPAGPPPEDVPGPPKRKEREAGNEPPTPRKKVKGGRERHLKK
VGGDACLLRGSDPGGPGLLPPRVLNPSQAFSSCHPGLPPENWEKPKPPLASSEGPAVPSP
SPQREKLERFKRMCQLLERVPDTSSSSSDSDSDSDSSGTSLSEDEAPGEARNGRRPARGS
SGEKENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSPEPDTLPLAAGS
DHPLPRAAWLRVFQHLGPRELCICMRVCRTWSRWCYDKRLWPRMDLSRRKSLTPPMLSGV
VRRQPRALDLSWTGVSKKQLMWLLNRLQGLQELVLSGCSWLSVSALGSAPLPALRLLDLR
WIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLS
ALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLR
SCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS
Download sequence
Identical sequences H0XB61
ENSOGAP00000012913 ENSOGAP00000012913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]