SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOGAP00000013015 from Otolemur garnettii 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOGAP00000013015
Domain Number 1 Region: 30-294
Classification Level Classification E-value
Superfamily RNI-like 7.46e-18
Family Cyclin A/CDK2-associated p19, Skp2 0.057
Further Details:      
 
Domain Number 2 Region: 5-39
Classification Level Classification E-value
Superfamily F-box domain 0.0000000235
Family F-box domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOGAP00000013015   Gene: ENSOGAG00000014529   Transcript: ENSOGAT00000014531
Sequence length 326
Comment pep:known_by_projection scaffold:OtoGar3:GL873646.1:4251069:4261319:1 gene:ENSOGAG00000014529 transcript:ENSOGAT00000014531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLAELPDSVLLEVFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMW
HLLRRYMASRLYSLRMGGYLFSGSQAPQLSPALLRALGQKCPNLKRLCLHVADLSMVPIT
SLPPTLRTLELHSCEISMAWLLKQEDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRS
LVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVGGL
SAPGLAVLEGMPALESLCLLGPLITPEMPSPTEILSSCLTMPKLRVLELQGLGWEGQEAE
RILCKGLPHCMVIVRACPKESMDWWM
Download sequence
Identical sequences H0XBE0
ENSOGAP00000013015 ENSOGAP00000013015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]